FAM71A polyclonal antibody
  • FAM71A polyclonal antibody

FAM71A polyclonal antibody

Ref: AB-PAB22158
FAM71A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM71A.
Información adicional
Size 100 uL
Gene Name FAM71A
Gene Alias FLJ32796|RP11-338C15.4
Gene Description family with sequence similarity 71, member A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SMSLSREGSVSLAIAGVVLTSRTAAEADMDAAAGPPVSTRQSKSSLSGQHGRERTQASAEGCKEGRERREKDRALGRSSHRRRTGESRHK
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM71A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 149647
Iso type IgG

Enviar uma mensagem


FAM71A polyclonal antibody

FAM71A polyclonal antibody