DNAH8 polyclonal antibody
  • DNAH8 polyclonal antibody

DNAH8 polyclonal antibody

Ref: AB-PAB22154
DNAH8 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DNAH8.
Información adicional
Size 100 uL
Gene Name DNAH8
Gene Alias ATPase|FLJ25850|FLJ36115|FLJ36334|hdhc9
Gene Description dynein, axonemal, heavy chain 8
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ILNHKSKHVEEAVRELISIFEQIYEVKYTGKVGKQSEQRKHVVFGSETEEGENNDYEANIVNEFDTHDKEDEFKKECKEVFAFFSHQLLDSLQKATRLSLD
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DNAH8.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1769
Iso type IgG

Enviar uma mensagem


DNAH8 polyclonal antibody

DNAH8 polyclonal antibody