TCTEX1D1 polyclonal antibody
  • TCTEX1D1 polyclonal antibody

TCTEX1D1 polyclonal antibody

Ref: AB-PAB22147
TCTEX1D1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TCTEX1D1.
Información adicional
Size 100 uL
Gene Name TCTEX1D1
Gene Alias FLJ40873|MGC125768|RP11-266I14.2
Gene Description Tctex1 domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MMSDNAKGRAAHSWKKRGSISSLSNHEFWRKEIHGRIKDSMSTVSYMEEPSQRDDISRLTVQMENTYQLGPPKHFPVVTVNHI
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TCTEX1D1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 200132
Iso type IgG

Enviar uma mensagem


TCTEX1D1 polyclonal antibody

TCTEX1D1 polyclonal antibody