CPSF3L polyclonal antibody
  • CPSF3L polyclonal antibody

CPSF3L polyclonal antibody

Ref: AB-PAB22137
CPSF3L polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CPSF3L.
Información adicional
Size 100 uL
Gene Name CPSF3L
Gene Alias CPSF73L|FLJ13294|FLJ20542|INT11|INTS11|RC-68|RC68
Gene Description cleavage and polyadenylation specific factor 3-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq LGLAEHQLRFTCRVHLHDTRKEQETALRVYSHLKSVLKDHCVQHLPDGSVTVESVLLQAAAPSEDPGTKVLLVSWTYQDEELGSFLTSLLKKG
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CPSF3L.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54973
Iso type IgG

Enviar uma mensagem


CPSF3L polyclonal antibody

CPSF3L polyclonal antibody