CASZ1 polyclonal antibody
  • CASZ1 polyclonal antibody

CASZ1 polyclonal antibody

Ref: AB-PAB22121
CASZ1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CASZ1.
Información adicional
Size 100 uL
Gene Name CASZ1
Gene Alias CST|FLJ12223|FLJ20321|SRG|ZNF693|dJ734G22.1
Gene Description castor zinc finger 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq STMTEFLGMFGYDDQNTRDELARKISFEKLHAGSTPEAATSSMLPTSEDTLSKRARFSKYEEYIRKLKAGEQLSWPAPSTKTEERVGKE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CASZ1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54897
Iso type IgG

Enviar uma mensagem


CASZ1 polyclonal antibody

CASZ1 polyclonal antibody