ODF2L polyclonal antibody
  • ODF2L polyclonal antibody

ODF2L polyclonal antibody

Ref: AB-PAB22106
ODF2L polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ODF2L.
Información adicional
Size 100 uL
Gene Name ODF2L
Gene Alias KIAA1229|MGC111060|RP5-977L11.1|dJ977L11.1
Gene Description outer dense fiber of sperm tails 2-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SVKVVHERLQIQIHKREAENDKLKEYVKSLETKIAKWNLQSRMNKNEAIVMKEASRQKTVALKKASKVYKQRLDHFTGAIE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ODF2L.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57489
Iso type IgG

Enviar uma mensagem


ODF2L polyclonal antibody

ODF2L polyclonal antibody