MAP7D1 polyclonal antibody
  • MAP7D1 polyclonal antibody

MAP7D1 polyclonal antibody

Ref: AB-PAB22101
MAP7D1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MAP7D1.
Información adicional
Size 100 uL
Gene Name MAP7D1
Gene Alias FLJ10350|FLJ39022|MGC117315|PARCC1|RPRC1
Gene Description MAP7 domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EPVKAVEARSPGLQKEAVQKEEPIPQEPQWSLPSKELPASLVNGLQPLPAHQENGFSTNGPSGDKSLSRTPETLLPFAEAEAFLKKAVVQSPQVTEVL
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MAP7D1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55700
Iso type IgG

Enviar uma mensagem


MAP7D1 polyclonal antibody

MAP7D1 polyclonal antibody