NAV1 polyclonal antibody
  • NAV1 polyclonal antibody

NAV1 polyclonal antibody

Ref: AB-PAB22080
NAV1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NAV1.
Información adicional
Size 100 uL
Gene Name NAV1
Gene Alias DKFZp781D0314|FLJ12560|FLJ14203|KIAA1151|MGC14961|POMFIL3|steerin-1
Gene Description neuron navigator 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq AKSFVKPPSLANLDKVNSNSLDLPSSSDTTHASKVPDLHATSSASGGPLPSCFTPSPAPILNINSASFSQGLELMSGFSVPKETRMYPKLSGLHRSMESLQMPMSLPSAFPSSTPVPTPPAPPAAPTEEETEELTWSGSP
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NAV1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 89796
Iso type IgG

Enviar uma mensagem


NAV1 polyclonal antibody

NAV1 polyclonal antibody