IRF2BP2 polyclonal antibody
  • IRF2BP2 polyclonal antibody

IRF2BP2 polyclonal antibody

Ref: AB-PAB22076
IRF2BP2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant IRF2BP2.
Información adicional
Size 100 uL
Gene Name IRF2BP2
Gene Alias MGC72189
Gene Description interferon regulatory factor 2 binding protein 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq QDWVNRPKTVRDTLLALHQHGHSGPFESKFKKEPALTAGRLLGFEANGANGSKAVARTARKRKPSPEPEGEVG
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human IRF2BP2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 359948
Iso type IgG

Enviar uma mensagem


IRF2BP2 polyclonal antibody

IRF2BP2 polyclonal antibody