NEO1 polyclonal antibody
  • NEO1 polyclonal antibody

NEO1 polyclonal antibody

Ref: AB-PAB22070
NEO1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NEO1.
Información adicional
Size 100 uL
Gene Name NEO1
Gene Alias DKFZp547A066|DKFZp547B146|HsT17534|IGDCC2|NGN
Gene Description neogenin homolog 1 (chicken)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NSKSIMIHWQPPAPATQNGQITGYKIRYRKASRKSDVTETLVSGTQLSQLIEGLDRGTEYNFRVAALTINGTGPATDWLSAETFE
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NEO1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 4756
Iso type IgG

Enviar uma mensagem


NEO1 polyclonal antibody

NEO1 polyclonal antibody