GBP6 polyclonal antibody
  • GBP6 polyclonal antibody

GBP6 polyclonal antibody

Ref: AB-PAB22067
GBP6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GBP6.
Información adicional
Size 100 uL
Gene Name GBP6
Gene Alias DKFZp686G0786|FLJ39135
Gene Description guanylate binding protein family, member 6
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq EREHLLREQIMMLEHTQKVQNDWLHEGFKKKYEEMNAEISQFKRMIDTTKNDDTPWIARTLDNLADELTAILSAPAKLIGHGVKGV
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GBP6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 163351
Iso type IgG

Enviar uma mensagem


GBP6 polyclonal antibody

GBP6 polyclonal antibody