DNAH14 polyclonal antibody
  • DNAH14 polyclonal antibody

DNAH14 polyclonal antibody

Ref: AB-PAB22065
DNAH14 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DNAH14.
Información adicional
Size 100 uL
Gene Name DNAH14
Gene Alias DKFZp781B1548|Dnahc14|HL-18|HL18
Gene Description dynein, axonemal, heavy chain 14
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq FIIPSIDDISAQLEESQVILATIKGSPHIGPIKDLVNEWDQNLTLFSYTLEEWMNCQRNWLYLEPVFHSSEIRR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DNAH14.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 127602
Iso type IgG

Enviar uma mensagem


DNAH14 polyclonal antibody

DNAH14 polyclonal antibody