PRR9 polyclonal antibody
  • PRR9 polyclonal antibody

PRR9 polyclonal antibody

Ref: AB-PAB22064
PRR9 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PRR9.
Información adicional
Size 100 uL
Gene Name PRR9
Gene Alias -
Gene Description proline rich 9
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QCQAKAEEVCLPTCQHPCQDKCLVQAQEVCLSQCQESSQEKCPQQGQEPYLPPCQDQCPPQCAEPCQELFQTKCVEVCPQKVQEKCSSPG
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PRR9.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 574414
Iso type IgG

Enviar uma mensagem


PRR9 polyclonal antibody

PRR9 polyclonal antibody