RC3H1 polyclonal antibody
  • RC3H1 polyclonal antibody

RC3H1 polyclonal antibody

Ref: AB-PAB22050
RC3H1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RC3H1.
Información adicional
Size 100 uL
Gene Name RC3H1
Gene Alias KIAA2025|RNF198|ROQUIN
Gene Description ring finger and CCCH-type zinc finger domains 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq AHSQEELEKFRKMNKRLVPRRPLSASLGQLNEVGLPSAAILPDEGAVDLPSRKPPALPNGIVSTGNTVTQLIPRGTDPSYDSSLKPG
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RC3H1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 149041
Iso type IgG

Enviar uma mensagem


RC3H1 polyclonal antibody

RC3H1 polyclonal antibody