CDC42SE1 polyclonal antibody
  • CDC42SE1 polyclonal antibody

CDC42SE1 polyclonal antibody

Ref: AB-PAB22049
CDC42SE1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CDC42SE1.
Información adicional
Size 100 uL
Gene Name CDC42SE1
Gene Alias SCIP1|SPEC1
Gene Description CDC42 small effector 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LGCCVVEKPQPKKKRRRIDRTMIGEPMNFVHLTHIGSGEMGAGDGLAMTGAVQEQMRSKGNR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CDC42SE1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 56882
Iso type IgG

Enviar uma mensagem


CDC42SE1 polyclonal antibody

CDC42SE1 polyclonal antibody