C8orf48 polyclonal antibody
  • C8orf48 polyclonal antibody

C8orf48 polyclonal antibody

Ref: AB-PAB22048
C8orf48 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C8orf48.
Información adicional
Size 100 uL
Gene Name C8orf48
Gene Alias FLJ25402
Gene Description chromosome 8 open reading frame 48
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq RDAFSCTVPDELLNRIYFKNMRTTPKQEAAAKQHISYQCPYCNRKRAELALSAFLKQKKTLLESFLLQERIDEHLHT
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C8orf48.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 157773
Iso type IgG

Enviar uma mensagem


C8orf48 polyclonal antibody

C8orf48 polyclonal antibody