NUS1 polyclonal antibody
  • NUS1 polyclonal antibody

NUS1 polyclonal antibody

Ref: AB-PAB22042
NUS1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NUS1.
Información adicional
Size 100 uL
Gene Name NUS1
Gene Alias C6orf68|MGC117249|MGC7199|MGC:7199|NgBR
Gene Description nuclear undecaprenyl pyrophosphate synthase 1 homolog (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ASLLSSNGCPDPDLVLKFGPVDSTLGFLPWHIRLTEIVSLPSHLNISYEDFFSALRQYAACEQRLGK
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NUS1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 116150
Iso type IgG

Enviar uma mensagem


NUS1 polyclonal antibody

NUS1 polyclonal antibody