CGN polyclonal antibody
  • CGN polyclonal antibody

CGN polyclonal antibody

Ref: AB-PAB22041
CGN polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CGN.
Información adicional
Size 100 uL
Gene Name CGN
Gene Alias DKFZp779N1112|FLJ39281|KIAA1319
Gene Description cingulin
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq GGDSFGVQIKGANDQGASGALSSDLELPENPYSQVKGFPAPSQSSTSDEEPGAYWNGKLLRSHSQASLAGPGPVDPSNRSNSMLELAPKV
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CGN.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57530
Iso type IgG

Enviar uma mensagem


CGN polyclonal antibody

CGN polyclonal antibody