MRPL55 polyclonal antibody
  • MRPL55 polyclonal antibody

MRPL55 polyclonal antibody

Ref: AB-PAB22040
MRPL55 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MRPL55.
Información adicional
Size 100 uL
Gene Name MRPL55
Gene Alias AAVG5835|DKFZp686D1387|L55nt|MGC61802|MRP-L55|PRO19675
Gene Description mitochondrial ribosomal protein L55
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PVLLVKQDGSTIHIRYREPRRMLAMPIDLDTLSPEERRARLRKREAQLQSRKEYEQELSDDLHVERYRQFWTRTKK
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MRPL55.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 128308
Iso type IgG

Enviar uma mensagem


MRPL55 polyclonal antibody

MRPL55 polyclonal antibody