CC2D1B polyclonal antibody
  • CC2D1B polyclonal antibody

CC2D1B polyclonal antibody

Ref: AB-PAB22029
CC2D1B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CC2D1B.
Información adicional
Size 100 uL
Gene Name CC2D1B
Gene Alias KIAA1836|RP11-155O18.2
Gene Description coiled-coil and C2 domain containing 1B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LESQLASVRRGRKINEDEIPPPVALGKRPLAPQEPANRSPETDPPAPPALESDNPSQPETSLPGISAQPVSDLDPDPRALLSSRQREYKVAALSAKRA
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CC2D1B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 200014
Iso type IgG

Enviar uma mensagem


CC2D1B polyclonal antibody

CC2D1B polyclonal antibody