OXR1 polyclonal antibody
  • OXR1 polyclonal antibody

OXR1 polyclonal antibody

Ref: AB-PAB22026
OXR1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant OXR1.
Información adicional
Size 100 uL
Gene Name OXR1
Gene Alias FLJ10125|FLJ38829|FLJ41673|FLJ42450|FLJ45656|Nbla00307
Gene Description oxidation resistance 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QDSFLHENSLHQEESQKENMPCGETAEFKQKQSVNKGKQGKEQNQDSQTEAEELRKLWKTHTMQQTKQQRENIQQVS
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human OXR1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55074
Iso type IgG

Enviar uma mensagem


OXR1 polyclonal antibody

OXR1 polyclonal antibody