SERTAD4 polyclonal antibody
  • SERTAD4 polyclonal antibody

SERTAD4 polyclonal antibody

Ref: AB-PAB22023
SERTAD4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SERTAD4.
Información adicional
Size 100 uL
Gene Name SERTAD4
Gene Alias DJ667H12.2
Gene Description SERTA domain containing 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq AKLNDEKANDDTNRDGGPLSHEPVGNDLAFECKGQFYDYFETGYNERNNVNESWKKSLRKKEASPPSNKLCCSKGSK
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SERTAD4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 56256
Iso type IgG

Enviar uma mensagem


SERTAD4 polyclonal antibody

SERTAD4 polyclonal antibody