POLR3GL polyclonal antibody
  • POLR3GL polyclonal antibody

POLR3GL polyclonal antibody

Ref: AB-PAB22018
POLR3GL polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant POLR3GL.
Información adicional
Size 100 uL
Gene Name POLR3GL
Gene Alias FLJ34890|MGC3200|RPC32HOM|flj32422
Gene Description polymerase (RNA) III (DNA directed) polypeptide G (32kD)-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq VGIGKGDALPPPTLQPSPLFPPLEFRPVPLPSGEEGEYVLALKQELRGAMRQLPYFIRPAVPKRDVERYSD
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human POLR3GL.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84265
Iso type IgG

Enviar uma mensagem


POLR3GL polyclonal antibody

POLR3GL polyclonal antibody