WDR47 polyclonal antibody
  • WDR47 polyclonal antibody

WDR47 polyclonal antibody

Ref: AB-PAB22017
WDR47 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant WDR47.
Información adicional
Size 100 uL
Gene Name WDR47
Gene Alias FLJ90135|KIAA0893
Gene Description WD repeat domain 47
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq LLYECCVEFCQSKATGEEITESEVLLGIDLLCGNGCDDLDLSLLSWLQNLPSSVFSCAFEQKMLNIHVDKLLKPTKAAYADLLTPLISKLSPYP
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human WDR47.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 22911
Iso type IgG

Enviar uma mensagem


WDR47 polyclonal antibody

WDR47 polyclonal antibody