KIF21B polyclonal antibody
  • KIF21B polyclonal antibody

KIF21B polyclonal antibody

Ref: AB-PAB22014
KIF21B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KIF21B.
Información adicional
Size 100 uL
Gene Name KIF21B
Gene Alias FLJ16314
Gene Description kinesin family member 21B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RKTQEVSALRRLAKPMSERVAGRAGLKPPMLDSGAEVSASTTSSEAESGARSVSSIVRQWNRKINHFLGDHPAPTVNGTRPARKKFQKKG
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KIF21B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23046
Iso type IgG

Enviar uma mensagem


KIF21B polyclonal antibody

KIF21B polyclonal antibody