MTERFD2 polyclonal antibody
  • MTERFD2 polyclonal antibody

MTERFD2 polyclonal antibody

Ref: AB-PAB22003
MTERFD2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MTERFD2.
Información adicional
Size 100 uL
Gene Name MTERFD2
Gene Alias FLJ16261|MGC61716
Gene Description MTERF domain containing 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq ARQTPHLGEQRRTTASLLRKLTTASNGGVIEELSCVRSNNYVQEPECRRNLVQCLLEKQGTPVVQGSLELERVMSSLLDMGFSNAHINELLSVRRGASLQQLLDIISEFILLGLNPEPVCVVLKKSPQLL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MTERFD2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 130916
Iso type IgG

Enviar uma mensagem


MTERFD2 polyclonal antibody

MTERFD2 polyclonal antibody