TTLL4 polyclonal antibody
  • TTLL4 polyclonal antibody

TTLL4 polyclonal antibody

Ref: AB-PAB22002
TTLL4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TTLL4.
Información adicional
Size 100 uL
Gene Name TTLL4
Gene Alias KIAA0173
Gene Description tubulin tyrosine ligase-like family, member 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq DGLEDCCSRDENEEEEGDSECSSLSAVSPSESVAMISRSCMEILTKPLSNHEKVVRPALIYSLFPNVPPTIYFGTRDERVEKLPWEQRKLLRWKMSTVTPNIVKQTIGRSHFKISKRNDDWLGCWGHHMKSPSFRSI
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TTLL4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9654
Iso type IgG

Enviar uma mensagem


TTLL4 polyclonal antibody

TTLL4 polyclonal antibody