TMEM199 polyclonal antibody
  • TMEM199 polyclonal antibody

TMEM199 polyclonal antibody

Ref: AB-PAB21999
TMEM199 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMEM199.
Información adicional
Size 100 uL
Gene Name TMEM199
Gene Alias C17orf32|MGC45714
Gene Description transmembrane protein 199
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq AGERLVRALGPGGELEPERLPRKLRAELEAALGKKHKGGDSSSGPQRLVSFRLIRDLHQHLRERDSKLYLHELLEGSEIYLPEVVKPPRNPELVARLEKIKIQLANEEYKRITRNVTCQDTRHGGTLSDLGKQVRSL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMEM199.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 147007
Iso type IgG

Enviar uma mensagem


TMEM199 polyclonal antibody

TMEM199 polyclonal antibody