TMTC2 polyclonal antibody
  • TMTC2 polyclonal antibody

TMTC2 polyclonal antibody

Ref: AB-PAB21989
TMTC2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMTC2.
Información adicional
Size 100 uL
Gene Name TMTC2
Gene Alias DKFZp762A217
Gene Description transmembrane and tetratricopeptide repeat containing 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KSPSVDRECNGKTVTNGKQNANGHSCLSDVEYQNSETKSSFASKVENGIKNDVSQRTQLPSTEN
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMTC2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 160335
Iso type IgG

Enviar uma mensagem


TMTC2 polyclonal antibody

TMTC2 polyclonal antibody