SEC11C polyclonal antibody
  • SEC11C polyclonal antibody

SEC11C polyclonal antibody

Ref: AB-PAB21982
SEC11C polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SEC11C.
Información adicional
Size 100 uL
Gene Name SEC11C
Gene Alias SEC11L3|SPC21|SPCS4C
Gene Description SEC11 homolog C (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq MVRAGAVGAHLPASGLDIFGDLKKMNKRQLYYQV
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SEC11C.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 90701
Iso type IgG

Enviar uma mensagem


SEC11C polyclonal antibody

SEC11C polyclonal antibody