PHF3 polyclonal antibody
  • PHF3 polyclonal antibody

PHF3 polyclonal antibody

Ref: AB-PAB21967
PHF3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PHF3.
Información adicional
Size 100 uL
Gene Name PHF3
Gene Alias KIAA0244|MGC142210|MGC142212
Gene Description PHD finger protein 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SFTTVLHKQRNKPQQNLQEDLPTAVEPLMEVTKQEPPKPLRFLPGVLIGWENQPTTLELANKPLPVDDILQSLLGTTGQVYDQAQSVMEQN
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PHF3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23469
Iso type IgG

Enviar uma mensagem


PHF3 polyclonal antibody

PHF3 polyclonal antibody