LEMD3 polyclonal antibody
  • LEMD3 polyclonal antibody

LEMD3 polyclonal antibody

Ref: AB-PAB21965
LEMD3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LEMD3.
Información adicional
Size 100 uL
Gene Name LEMD3
Gene Alias MAN1
Gene Description LEM domain containing 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq QGQAFHLDRRNSPPNSLTPCLKIRNMFDPVMEIGDQWHLAIQEAILEKCSDNDGIVHIAVDKNSREGCVYVKCLSPEYAGKAFKALHGSWFDGKLVTVKYLRLDRYHHRFPQALTSNTPLKPSNKHMNSMSHLRLRT
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LEMD3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23592
Iso type IgG

Enviar uma mensagem


LEMD3 polyclonal antibody

LEMD3 polyclonal antibody