SMG8 polyclonal antibody
  • SMG8 polyclonal antibody

SMG8 polyclonal antibody

Ref: AB-PAB21964
SMG8 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SMG8.
Información adicional
Size 100 uL
Gene Name SMG8
Gene Alias FLJ10587
Gene Description chromosome 17 open reading frame 71
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SINCLFTVPANQAFVYIVPGSQEEDPVGMLLDQLRSHCTVKDPESLLVPAPLSGPRRYQVMRQHSRQQLSFHIDSSSSSSSGQLVDFTLREFLWQHVELVLSKKGFDDSVGRNPQPSHFELPTYQKWISAASK
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SMG8.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55181
Iso type IgG

Enviar uma mensagem


SMG8 polyclonal antibody

SMG8 polyclonal antibody