DPY19L4 polyclonal antibody
  • DPY19L4 polyclonal antibody

DPY19L4 polyclonal antibody

Ref: AB-PAB21959
DPY19L4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DPY19L4.
Información adicional
Size 100 uL
Gene Name DPY19L4
Gene Alias MGC131885
Gene Description dpy-19-like 4 (C. elegans)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ELEREITFQGDSAIYYSYYKDMLKAPSFERGVYELTHNNKTVSLKTINAVQQMSLYPELIASILYQATG
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DPY19L4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 286148
Iso type IgG

Enviar uma mensagem


DPY19L4 polyclonal antibody

DPY19L4 polyclonal antibody