LURAP1L polyclonal antibody
  • LURAP1L polyclonal antibody

LURAP1L polyclonal antibody

Ref: AB-PAB21950
LURAP1L polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LURAP1L.
Información adicional
Size 100 uL
Gene Name LURAP1L
Gene Alias HYST0841|C9orf150|bA3L8.2
Gene Description leucine rich adaptor protein 1-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KVPESLVRSLRGEEPVPRERDRDPCGGSGGGGGGGGGCSSSSSYCSFPPSLSSSSSSSPTSGSPRGSHSSALERLETKLHLLRQEMVNLRATDVRLMRQLLVINESIESIKW
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LURAP1L.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 286343
Iso type IgG

Enviar uma mensagem


LURAP1L polyclonal antibody

LURAP1L polyclonal antibody