C1orf144 polyclonal antibody
  • C1orf144 polyclonal antibody

C1orf144 polyclonal antibody

Ref: AB-PAB21949
C1orf144 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C1orf144.
Información adicional
Size 100 uL
Gene Name C1orf144
Gene Alias DKFZp566C0424|MGC70432
Gene Description chromosome 1 open reading frame 144
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq PNSTSRPTLPVKSLAQREAEYAEARKRILGSASPEEEQEKPILDRPTRISQPEDSRQPNNVIRQPLGPDGSQGFKQR
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C1orf144.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 26099
Iso type IgG

Enviar uma mensagem


C1orf144 polyclonal antibody

C1orf144 polyclonal antibody