AQP6 polyclonal antibody
  • AQP6 polyclonal antibody

AQP6 polyclonal antibody

Ref: AB-PAB21937
AQP6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant AQP6.
Información adicional
Size 100 uL
Gene Name AQP6
Gene Alias AQP2L|KID
Gene Description aquaporin 6, kidney specific
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PDTKTLAQRLAILTGTVEVGTGAGAGAEPLKKESQPGSGAVEME
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human AQP6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 363
Iso type IgG

Enviar uma mensagem


AQP6 polyclonal antibody

AQP6 polyclonal antibody