SLC25A22 polyclonal antibody
  • SLC25A22 polyclonal antibody

SLC25A22 polyclonal antibody

Ref: AB-PAB21935
SLC25A22 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC25A22.
Información adicional
Size 100 uL
Gene Name SLC25A22
Gene Alias FLJ13044|GC1
Gene Description solute carrier family 25 (mitochondrial carrier: glutamate), member 22
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P,IF
Immunogen Prot. Seq RSEGYFGMYRGAAVNLTLVTPEKAIKLAANDFFRHQLSKDGQKLTLLKEMLAGCGAGTCQVIVTTPMEMLKIQLQDAGRIAAQRKILAAQGQLSAQGGAQPSVE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC25A22.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79751
Iso type IgG

Enviar uma mensagem


SLC25A22 polyclonal antibody

SLC25A22 polyclonal antibody