TMEM30A polyclonal antibody
  • TMEM30A polyclonal antibody

TMEM30A polyclonal antibody

Ref: AB-PAB21934
TMEM30A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMEM30A.
Información adicional
Size 100 uL
Gene Name TMEM30A
Gene Alias C6orf67|CDC50A|FLJ10856
Gene Description transmembrane protein 30A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VKSRDDSQLNGDSSALLNPSKECEPYRRNEDKPIAPCGAIANSMFNDTLELFLIGNDSYPIPIALKKKGIAWWTDKNVKFRNPPGGDNLEERFKGTTKPVNWLKPVYMLDSDPDNNGFI
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMEM30A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55754
Iso type IgG

Enviar uma mensagem


TMEM30A polyclonal antibody

TMEM30A polyclonal antibody