PRR12 polyclonal antibody
  • PRR12 polyclonal antibody

PRR12 polyclonal antibody

Ref: AB-PAB21927
PRR12 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PRR12.
Información adicional
Size 100 uL
Gene Name PRR12
Gene Alias KIAA1205
Gene Description proline rich 12
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TKVKAEPPPKKRKKWLKEAGGNATAGGGPPGSSSDSESSPGAPSEDERAVPGRLLKTRAMREMYRSYVEMLVSTALDPD
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PRR12.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57479
Iso type IgG

Enviar uma mensagem


PRR12 polyclonal antibody

PRR12 polyclonal antibody