TEX13B polyclonal antibody
  • TEX13B polyclonal antibody

TEX13B polyclonal antibody

Ref: AB-PAB21926
TEX13B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TEX13B.
Información adicional
Size 100 uL
Gene Name TEX13B
Gene Alias TGC3B|TSGA5
Gene Description testis expressed 13B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq AGEQEKEAVAAAGAAGGKGEERYAEAGPAPAEVLQGLGGGFRQPLGAIVAGKLHLCGAEGERSQVSTNSHVCLLWAWVHSLTGASSCPAPYLIHILIPMPFVRLLSHTQYTPFTSKGHRTGSNS
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TEX13B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 56156
Iso type IgG

Enviar uma mensagem


TEX13B polyclonal antibody

TEX13B polyclonal antibody