C12orf53 polyclonal antibody
  • C12orf53 polyclonal antibody

C12orf53 polyclonal antibody

Ref: AB-PAB21925
C12orf53 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C12orf53.
Información adicional
Size 100 uL
Gene Name C12orf53
Gene Alias DKFZp547D2210
Gene Description chromosome 12 open reading frame 53
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq DRSQKRRRPSGQQGALRQEESQQPLTDLSPAGVTVLGAFGDSPTPTPDHEEPRGGPRPGMPHPKGAPAFQLNR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C12orf53.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 196500
Iso type IgG

Enviar uma mensagem


C12orf53 polyclonal antibody

C12orf53 polyclonal antibody