SERINC2 polyclonal antibody
  • SERINC2 polyclonal antibody

SERINC2 polyclonal antibody

Ref: AB-PAB21920
SERINC2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SERINC2.
Información adicional
Size 100 uL
Gene Name SERINC2
Gene Alias FKSG84|MGC90340|PRO0899|TDE2|TDE2L
Gene Description serine incorporator 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RSSDHRQVNSLMQTEECPPMLDATQQQQQQVAACEGRAFDNEQDGVT
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SERINC2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 347735
Iso type IgG

Enviar uma mensagem


SERINC2 polyclonal antibody

SERINC2 polyclonal antibody