CHST7 polyclonal antibody
  • CHST7 polyclonal antibody

CHST7 polyclonal antibody

Ref: AB-PAB21914
CHST7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CHST7.
Información adicional
Size 100 uL
Gene Name CHST7
Gene Alias C6ST-2
Gene Description carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 7
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PMWHLWQALYPGDAESLQGALRDMLRSLFRCDFSVLRLYAPPGDPAARAPDTANLTTAALFRWRTNKVICSPPLCPGAPRARAEVGLVEDTACERSCPPVAIRALEAECRKYPVVVIKDVRLLDLGVLVPLLRDPGLNLKVVQL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CHST7.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 56548
Iso type IgG

Enviar uma mensagem


CHST7 polyclonal antibody

CHST7 polyclonal antibody