NOL12 polyclonal antibody
  • NOL12 polyclonal antibody

NOL12 polyclonal antibody

Ref: AB-PAB21911
NOL12 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NOL12.
Información adicional
Size 100 uL
Gene Name NOL12
Gene Alias FLJ34609|MGC3731|Nop25|dJ37E16.7
Gene Description nucleolar protein 12
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq HQEYLKMLAEREEALEEADELDRLVTAKTESVQYDHPNHTVTVTTISDLDLSGARLLGLTPPEGGAGDRSEEEASSTEKPTKALPRKSRDPLLSQRISSLTASLHAHSRKKVKRKHPRRAQDSKKPPRAPRTSKAQRRRLTGKAR
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NOL12.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79159
Iso type IgG

Enviar uma mensagem


NOL12 polyclonal antibody

NOL12 polyclonal antibody