PRSS38 polyclonal antibody
  • PRSS38 polyclonal antibody

PRSS38 polyclonal antibody

Ref: AB-PAB21905
PRSS38 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PRSS38.
Información adicional
Size 100 uL
Gene Name PRSS38
Gene Alias MGC163272
Gene Description marapsin 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NLTSANCWATGWGLVSKQGETSDELQEMQLPLILEPWCHLLYGHMSYIMPDMLCAGDILNAKTVCEGDS
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PRSS38.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 339501
Iso type IgG

Enviar uma mensagem


PRSS38 polyclonal antibody

PRSS38 polyclonal antibody