STAP2 polyclonal antibody
  • STAP2 polyclonal antibody

STAP2 polyclonal antibody

Ref: AB-PAB21900
STAP2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant STAP2.
Información adicional
Size 100 uL
Gene Name STAP2
Gene Alias BKS|FLJ20234
Gene Description signal transducing adaptor family member 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QGLTIYFYNSNRDFQHVEKLNLGAFEKLTDEIPWGSSRDPGTHFSLILRNQEIKFKVETLECREMWKGFILTVVELRVPTDLTLLPGHLYMMSEVLAKEEARRALETPSCFLKVSRLEAQLLLE
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human STAP2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55620
Iso type IgG

Enviar uma mensagem


STAP2 polyclonal antibody

STAP2 polyclonal antibody