EXOC8 polyclonal antibody
  • EXOC8 polyclonal antibody

EXOC8 polyclonal antibody

Ref: AB-PAB21899
EXOC8 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant EXOC8.
Información adicional
Size 100 uL
Gene Name EXOC8
Gene Alias EXO84|Exo84p|SEC84
Gene Description exocyst complex component 8
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq RDHLRGQAGFFSTPGGASRDGSGPGEEGKQRTLTTLLEKVEGCRHLLETPGQYLVYNGDLVEYDADHMAQLQRVHGFLMNDCLLVATWLPQRRGMYRYNAL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human EXOC8.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 149371
Iso type IgG

Enviar uma mensagem


EXOC8 polyclonal antibody

EXOC8 polyclonal antibody