ARID4B polyclonal antibody
  • ARID4B polyclonal antibody

ARID4B polyclonal antibody

Ref: AB-PAB21892
ARID4B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ARID4B.
Información adicional
Size 100 uL
Gene Name ARID4B
Gene Alias BCAA|BRCAA1|DKFZp313M2420|MGC163290|RBBP1L1|RBP1L1|SAP180
Gene Description AT rich interactive domain 4B (RBP1-like)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DNNGKEESKIDHLTNNRNDLISKEEQNSSSLLEENKVHADLVISKPVSKSPERLRKDIEVLSEDTDYEEDEVTKKRKDVKKDTTDKSSKPQIKRGKR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ARID4B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51742
Iso type IgG

Enviar uma mensagem


ARID4B polyclonal antibody

ARID4B polyclonal antibody