ABL1 polyclonal antibody
  • ABL1 polyclonal antibody

ABL1 polyclonal antibody

Ref: AB-PAB21888
ABL1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ABL1.
Información adicional
Size 100 uL
Gene Name ABL1
Gene Alias ABL|JTK7|bcr/abl|c-ABL|p150|v-abl
Gene Description c-abl oncogene 1, receptor tyrosine kinase
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq TEWRSVTLPRDLQSTGRQFDSSTFGGHKSEKPALPRKRAGENRSDQVTRGTVTPPPRLVKKNEEAADEVFKDIMESSP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ABL1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 25
Iso type IgG

Enviar uma mensagem


ABL1 polyclonal antibody

ABL1 polyclonal antibody